PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G10280.1
Common NameATMYB64, ATMYB92, F18D22_50, MYB92
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 334aa    MW: 37653 Da    PI: 6.1765
Description myb domain protein 92
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G10280.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ede+lv++v+++G  +W++ ++  g++R++k+c++rw +yl
      AT5G10280.1 14 KGPWTPDEDEKLVNYVQKHGHSSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.84.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr++++E++ +++++  lG++ W+tIa+ ++ gRt++++k++w+++l
      AT5G10280.1  67 RGRFSPDEEQTILNLHSVLGNK-WSTIANQLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-24764IPR009057Homeodomain-like
PROSITE profilePS5129418.363961IPR017930Myb domain
SuperFamilySSF466891.27E-3111108IPR009057Homeodomain-like
SMARTSM007173.6E-151363IPR001005SANT/Myb domain
PfamPF002491.1E-171461IPR001005SANT/Myb domain
CDDcd001673.00E-121661No hitNo description
PROSITE profilePS5129426.03162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2765117IPR009057Homeodomain-like
SMARTSM007174.3E-1566114IPR001005SANT/Myb domain
PfamPF002494.4E-1567112IPR001005SANT/Myb domain
CDDcd001673.53E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRSPISDDS GLKKGPWTPD EDEKLVNYVQ KHGHSSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGRF SPDEEQTILN LHSVLGNKWS TIANQLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSGLSQLM SLSSNLRGFV DLQQQFPIDQ EHTILKLQTE MAKLQLFQYL  180
LQPSSMSNNV NPNDFDTLSL LNSIASFKET SNNTTSNNLD LGFLGSYLQD FHSLPSLKTL  240
NSNMEPSSVF PQNLDDNHFK FSTQRENLPV SPIWLSDPSS TTPAHVNDDL IFNQYGIEDV  300
NSNITSSSGQ ESGASASAAW PDHLLDDSIF SDIP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.59990.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306830900.0
Genevisible250450_at0.0
Expression AtlasAT5G10280-
AtGenExpressAT5G10280-
ATTED-IIAT5G10280-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB92).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00503DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G10280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDjasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G10280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196190.0AY519619.1 Arabidopsis thaliana MYB transcription factor (At5g10280) mRNA, complete cds.
GenBankBT0028770.0BT002877.1 Arabidopsis thaliana clone RAFL14-88-D17 (R20400) putative myb family transcription factor (At5g10280) mRNA, complete cds.
GenBankBT0044020.0BT004402.1 Arabidopsis thaliana clone U20400 putative myb family transcription factor (At5g10280) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196590.10.0myb domain protein 92
SwissprotQ8GWP03e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLQ9SBF30.0Q9SBF3_ARATH; MYB transcription factor
STRINGAT5G10280.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Ma L, et al.
    Genomic evidence for COP1 as a repressor of light-regulated gene expression and development in Arabidopsis.
    Plant Cell, 2002. 14(10): p. 2383-98
    [PMID:12368493]
  4. Nikiforova V, et al.
    Transcriptome analysis of sulfur depletion in Arabidopsis thaliana: interlacing of biosynthetic pathways provides response specificity.
    Plant J., 2003. 33(4): p. 633-50
    [PMID:12609038]
  5. Rogers LA, et al.
    Comparison of lignin deposition in three ectopic lignification mutants.
    New Phytol., 2005. 168(1): p. 123-40
    [PMID:16159327]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  8. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]